FACTOID # 162: You are more likely to be reported as having been killed by lightning in Cuba than in any other country.
 
 Home   Encyclopedia   Statistics   Countries A-Z   Flags   Maps   Education   Forum   FAQ   About 
 
 
 
WHAT'S NEW
RECENT ARTICLES
More Recent Articles »
 

SEARCH ALL

FACTS & STATISTICS    Advanced view

Search encyclopedia, statistics and forums:

 

 

(* = Graphable)

 

 


Encyclopedia > FASTA format

In bioinformatics, FASTA format is a file format used to exchange information between genetic sequence databases. Its format looks like this: Bioinformatics or computational biology is the use of techniques from applied mathematics, informatics, statistics, and computer science to solve biological problems. ... A file format is a particular way to encode information for storage in a computer file. ... Genetics (from the Greek genno γεννώ= give birth) is the science of genes, heredity, and the variation of organisms. ... In the field of bioinformatics, a sequence database is a large collection of DNA, protein, or other sequences stored on a computer. ...

 >SEQUENCE_1 ;comment line 1 (optional) MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL >SEQUENCE_2 ;comment line 1 (optional) ;comment line 2 (optional) SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH 

It consists of a header line (beginning with a '>') which gives a name and/or a unique identifier for the sequence, and often lots of other information too. Many different sequence databases use standarized headers, which helps when automatically extracting information from the header. Often the first 'word' of the header is a unique identifier for the sequence. The header line may contain more than one header, separated by a ^A (Control-A) character (as in ftp://ftp.ncbi.nih.gov/blast/db/FASTA/nr.gz ). This should be interpreted as both headers pointing to the same sequence below. In the field of bioinformatics, a sequence database is a large collection of DNA, protein, or other sequences stored on a computer. ...


After the header line, one or more comments, distinguished by a semi-colon at the beginning of the line, may occur. Most databases and bioinformatics applications do not recognize these comments so their use is discouraged, but they are part of the official format.


After the header line and comments, one or more sequence lines may follow: each line of a sequence should have fewer than 80 characters. Sequences may be protein sequences or DNA sequences, and they can contain gaps or alignment characters (see sequence alignment). A protein primary structure is a chain of amino acids. ... part of a DNA sequence A DNA sequence (sometimes genetic sequence) is a succession of letters representing the primary structure of a real or hypothetical DNA molecule or strand, The possible letters are A, C, G, and T, representing the four nucleotide subunits of a DNA strand (adenine, cytosine, guanine... Sequence alignment is an arrangement of two or more sequences, highlighting their similarity. ...


FASTA format files often have file extensions like .fa, .mpfa, fna, or .fsa (and probably many more!). A filename extension or filename suffix is an extra set of (usually) alphanumeric characters that is appended to the end of a filename to allow computer users (as well as various pieces of software on the computer system) to quickly determine the type of data stored in the file. ...


The simple format of FASTA files makes them easy to manipulate using text processing tools and scripting languages like Perl. Scripting languages (commonly called scripting programming languages or script languages) are computer programming languages initially designed for scripting the operations of a computer. ... Perl, (also backronymed as Practical Extraction and Report Language, see below) is an interpreted procedural programming language designed by Larry Wall. ...


The NCBI have gone so far as to define a standard for their fasta header (although generally this is a bit messy). The formatdb man page has this to say on the subject of FASTA format databases, "formatdb will automatically parse the SeqID and create indexes, but the database identifiers in the FASTA definition line must follow the conventions of the FASTA Defline Format." Almost all substantial UNIX and Unix-like operating systems have extensive documentation available as an electronic manual, split into multiple sections called man pages (short for manual pages and based on the command used to display them). ...


However they do not give a difinitive description of the FASTA defline format, an attempt to create such a format is given below.

 GenBank gi|gi-number|gb|accession|locus EMBL Data Library gi|gi-number|emb|accession|locus DDBJ, DNA Database of Japan gi|gi-number|dbj|accession|locus NBRF PIR pir||entry Protein Research Foundation prf||name SWISS-PROT sp|accession|name Brookhaven Protein Data Bank (1) pdb|entry|chain Brookhaven Protein Data Bank (2) entry:chain|PDBID|CHAIN|SEQUENCE Patents pat|country|number GenInfo Backbone Id bbs|number General database identifier gnl|database|identifier NCBI Reference Sequence ref|accession|locus Local Sequence identifier lcl|identifier 

See also

FASTA is a sequence alignment package first described (as FASTP) by David J. Lipman and William R. Pearson in 1985 in the article Rapid and sensitive protein similarity searches. ...

External link


  Results from FactBites:
 
FASTA format description (124 words)
Latest news: New BLAST design to be released on April 16, 2007
A sequence in FASTA format begins with a single-line description, followed by lines of sequence data.
The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column.
  More results at FactBites »


 
 

COMMENTARY     


Share your thoughts, questions and commentary here
Your name
Your comments

Want to know more?
Search encyclopedia, statistics and forums:

 


Lesson Plans | Student Area | Student FAQ | Reviews | Press Releases |  Feeds | Contact
The Wikipedia article included on this page is licensed under the GFDL.
Images may be subject to relevant owners' copyright.
All other elements are (c) copyright NationMaster.com 2003-5. All Rights Reserved.
Usage implies agreement with terms, 1022, m